Pfam domain
Pfam family: GTP_EFTU_D2 (PF03144.24)
Uniprot AC: Q15029
RecName: 116 kDa U5 small nuclear ribonucleoprotein component
Begin-End: 489-566
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGN
WVLIEGVDQPIVKTATIT
Structures of the domain Q15029 489-566
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 B 491-566 None
5o9z X-ray 4.5 B 491-566 None


© NPIDB team 2003 - 2019

text