Pfam domain
Pfam family: EFG_C (PF00679.23)
Uniprot AC: Q15029
RecName: 116 kDa U5 small nuclear ribonucleoprotein component
Begin-End: 826-915
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFET
DLRTHTQGQAFSLSVFHHWQIVPGDPLDKS
Structures of the domain Q15029 826-915
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 B 826-914 None
5o9z X-ray 4.5 B 826-914 None


© NPIDB team 2003 - 2019

text