Pfam domain
Pfam family: CDC27 (PF09507.12)
Uniprot AC: Q15054
RecName: DNA polymerase delta subunit 3
Begin-End: 19-144
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVA
VVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCA
AAVPRA
Structures of the domain Q15054 19-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tnz X-ray 4.05 C 19-144 None
6s1m X-ray 4.27 C 19-144 None
6s1n X-ray 4.86 C 19-144 None
6s1o X-ray 8.1 C 19-144 None
6tny X-ray 3.08 C 19-144 None


© NPIDB team 2003 - 2021

text