Pfam domain
Pfam family: WD40 (PF00400.34)
Uniprot AC: Q15291
RecName: Retinoblastoma-binding protein 5
Begin-End: 58-94
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWD
Structures of the domain Q15291 58-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kix X-ray 4.1 N 58-94 None
6pww X-ray 4.4 A 58-94 None
6kiu X-ray 3.2 N 58-94 None
6pwv X-ray 6.2 A 58-94 None
6kiz X-ray 4.5 N 58-94 None
6pwx X-ray 4.2 A 58-94 None
6kiw X-ray 4 N 58-94 None
6kiv X-ray 4 N 58-94 None


© NPIDB team 2003 - 2021

text