Pfam domain
Pfam family: CPSF_A (PF03178.14)
Uniprot AC: Q15393
RecName: Splicing factor 3B subunit 3
Begin-End: 863-1184
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAG
GFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCE
NKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYD
TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVL
SLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLS
FRSYYFPVKNVIDGDLCEQFNS
Structures of the domain Q15393 863-1184
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 w 863-1183 None


© NPIDB team 2003 - 2019

text