Pfam domain
Pfam family: TAFII55_N (PF04658.12)
Uniprot AC: Q15545
RecName: Transcription initiation factor TFIID subunit 7
Begin-End: 12-154
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLP
CVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFI
WNHGITLPLKNVRKRRFRKTAKK
Structures of the domain Q15545 12-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fur X-ray 8.5 H 12-154 None


© NPIDB team 2003 - 2020

text