Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: Q15554
RecName: Telomeric repeat-binding factor 2
Begin-End: 489-537
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
KQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMK
Structures of the domain Q15554 489-537
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1w0u X-ray 1.8 B 447-495  H-Bb H-Mj L-Bb L-Mn 
1w0u X-ray 1.8 A 447-495  H-Bb H-Mj L-Bb L-Mn 
1vfc NMR A 447-494  H-Bb H-Mj L-Bb 
3sjm X-ray 1.35 A 447-495  H-Bb H-Mj L-Bb L-Mn 
3sjm X-ray 1.35 B 447-495  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2020

text