Pfam domain
Pfam family: E2F_TDP (PF02319.19)
Uniprot AC: Q16254
RecName: Transcription factor E2F4
Begin-End: 18-82
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
HEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKN
SIQWK
Structures of the domain Q16254 18-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cf7 X-ray 2.6 A 19-81  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text