Pfam domain
Pfam family: CPSF_A (PF03178.14)
Uniprot AC: Q16531
RecName: DNA damage-binding protein 1
Begin-End: 788-1099
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGR
IVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYN
NIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLG
AENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGS
VLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATG
FIDGDLIESFLD
Structures of the domain Q16531 788-1099
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ei1 X-ray 2.8 A 791-1099 None
3ei2 X-ray 2.6 A 791-1099 None
4e54 X-ray 2.85 A 791-1099 None
4e5z X-ray 3.22 A 791-1099 None


© NPIDB team 2003 - 2019

text