Pfam domain
Pfam family: HIN (PF02760.14)
Uniprot AC: Q16666
RecName: Gamma-interferon-inducible protein 16
Begin-End: 201-369
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIII
ISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVF
MLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRL
Structures of the domain Q16666 201-369
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qgu X-ray 2.54 A 201-369 None
4qgu X-ray 2.54 B 201-369 None


© NPIDB team 2003 - 2019

text