Pfam domain
Pfam family: HIN (PF02760.14)
Uniprot AC: Q16666
RecName: Gamma-interferon-inducible protein 16
Begin-End: 574-740
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
QSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIA
NYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEV
HKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFEL
Structures of the domain Q16666 574-740
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3rnu X-ray 2.5 D 574-740 None
3rnu X-ray 2.5 A 574-740  H-Bb S-Bb 
3rnu X-ray 2.5 C 574-740  H-Bb L-Bb 
3rnu X-ray 2.5 B 574-740  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text