Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q16695
RecName: Histone H3.1t
Begin-End: 39-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACE
SYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIR
Structures of the domain Q16695 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3a6n X-ray 2.7 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3a6n X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text