Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: Q17034
RecName: AGAP009515-PA
Begin-End: 50-221
Organism: Anopheles gambiae
Interaction Mode:   

Sequence:
VEITEQPHPKALRFRYECEGRSAGSIPGVNTTAEQKTFPSIQVHGYRGRAVVVVSCVTKE
GPEHKPHPHNLVGKEGCKKGVCTVEINSTTMSYTFNNLGIQCVKKKDVEEALRLRQEIRV
DPFRTGFGHAKEPGSIDLNAVRLCFQVFLEGQQRGRFTEPLTPVVSDIIYDK
Structures of the domain Q17034 50-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1bvo X-ray 2.7 A 50-221 None


© NPIDB team 2003 - 2019

text