Pfam domain
Pfam family: RNA_pol_Rpb4 (PF03874.15)
Uniprot AC: Q1JQ91
RecName: Polymerase (RNA) II (DNA directed) polypeptide D
Begin-End: 31-138
Organism: Bos taurus
Interaction Mode:   

Sequence:
TLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQK
KLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKR
Structures of the domain Q1JQ91 31-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 D 32-136 None
5flm X-ray 3.4 D 32-136 None


© NPIDB team 2003 - 2019

text