Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: Q1K502
RecName: FRQ-interacting RNA helicase
Begin-End: 426-582
Organism: Neurospora crassa
Interaction Mode:   

Sequence:
ADIAKIIKMILKKNFQPVIVFNFSKRECEQMALASSSMKFNAPDEENMVNKVFENALASL
SEDDKNLPQISNILPLLRKGIGVHHSGLLPILKETIEILFQEGLIKVLFATETFSIGLNM
PARTVVFTQVTKWDGQQRRPLTSSEYIQMAGRAGRRG
Structures of the domain Q1K502 426-582
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e02 X-ray 3.8 A 504-582 None


© NPIDB team 2003 - 2019

text