Pfam domain
Pfam family: Ribosomal_L14e (PF01929.16)
Uniprot AC: Q24C27
RecName: 60S ribosomal protein L14
Begin-End: 44-80
Organism: Tetrahymena thermophila
Interaction Mode:   

Sequence:
VRQVIPIRRVHLTKFQIDNVELNQRTVLLKKKIAKFD
Structures of the domain Q24C27 44-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4adx X-ray 6.6 7 45-79 None


© NPIDB team 2003 - 2019

text