Pfam domain
Pfam family: Dimer_Tnp_hAT (PF05699.13)
Uniprot AC: Q25442
RecName: Transposase
Begin-End: 523-604
Organism: Musca domestica
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
EFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTFSLAGNII
TEKRNRIGQQTVDSLLFLNSFY
Structures of the domain Q25442 523-604
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d1q X-ray 3.4 H 524-602  H-Bb H-Mn L-Bb L-Mn 
4d1q X-ray 3.4 G 524-602  H-Bb H-Mn L-Mn 
4d1q X-ray 3.4 B 524-602  H-Bb H-Mn L-Bb L-Mn 
4d1q X-ray 3.4 A 524-602  H-Bb H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2019

text