Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q28D68
RecName: Histone H2B
Begin-End: 32-102
Organism: Xenopus tropicalis
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTIT
SREIQTAVRLL
Structures of the domain Q28D68 32-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3c1c X-ray 3.15 H 1429-1497  H-Bb S-Bb L-Bb 
3c1c X-ray 3.15 D 1231-1297  S-Bb L-Bb 
3c1b X-ray 2.2 D 1229-1297  H-Bb S-Bb L-Bb 
3c1b X-ray 2.2 H 1429-1497  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text