Pfam domain
Pfam family: Ribosomal_L25p (PF01386.18)
Uniprot AC: Q2FJE0
RecName: 50S ribosomal protein L25
Begin-End: 4-91
Organism: Staphylococcus aureus
Interaction Mode: None

Sequence:
LKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGVIEL
GVGSKTIKVMVADYQFDPLKNQITHIDF
Structures of the domain Q2FJE0 4-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wf9 X-ray 3.43 S 8-91 None
4wfa X-ray 3.39 S 8-91 None


© NPIDB team 2003 - 2020

text