Pfam domain
Pfam family: Ribosomal_TL5_C (PF14693.5)
Uniprot AC: Q2FJE0
RecName: 50S ribosomal protein L25
Begin-End: 99-169
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
ERTVEVPVQLVGEAVGAKEGGVVEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVAD
VKVTGDFKIEN
Structures of the domain Q2FJE0 99-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wf9 X-ray 3.43 S 101-167 None
4wfa X-ray 3.39 S 101-167 None


© NPIDB team 2003 - 2020

text