Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: Q2FUQ0
RecName: 50S ribosomal protein L34
Begin-End: 2-45
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
VKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
Structures of the domain Q2FUQ0 2-45
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 2 3-45 None
5nrg X-ray 3.44 2 3-45 None
4wce X-ray 3.53 2 3-45 None
5hl7 X-ray 3.55 2 3-44 None
4wfb X-ray 3.43 2 3-45 None
4wf9 X-ray 3.43 2 3-45 None
4wfa X-ray 3.39 2 3-45 None


© NPIDB team 2003 - 2019

text