Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: Q2FW06
RecName: 50S ribosomal protein L3
Begin-End: 90-216
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
EFRNVDVDAYEVGQEVSVDTFVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMSHGSHFHR
APGSVGMASDASRVFKGQKMPGRMGGNTVTVQNLEVVQVDTENKVILVKGNVPGPKKGLV
EIRTSIK
Structures of the domain Q2FW06 90-216
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 B 106-190 None
5nrg X-ray 3.44 B 106-190 None
4wce X-ray 3.53 B 106-190 None
5hl7 X-ray 3.55 B 106-190 None
4wfb X-ray 3.43 B 106-190 None
4wf9 X-ray 3.43 B 106-190 None
4wfa X-ray 3.39 B 106-190 None


© NPIDB team 2003 - 2019

text