Pfam domain
Pfam family: Ribosomal_L4 (PF00573.21)
Uniprot AC: Q2FW07
RecName: 50S ribosomal protein L4
Begin-End: 17-201
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
IELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGGGRKPWKQKGTGRARQG
TIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQENGLTVVDAFNFEAPKT
KEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGLNVLDITNADSLVITE
AAAKK
Structures of the domain Q2FW07 17-201
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 C 17-201 None
5nrg X-ray 3.44 C 17-201 None
4wce X-ray 3.53 C 17-201 None
5hl7 X-ray 3.55 C 17-201 None
4wfb X-ray 3.43 C 17-201 None
4wf9 X-ray 3.43 C 17-201 None
4wfa X-ray 3.39 C 17-201 None


© NPIDB team 2003 - 2019

text