Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: Q2FW11
RecName: 50S ribosomal protein L22
Begin-End: 5-108
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
AVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHNYDM
NTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVS
Structures of the domain Q2FW11 5-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 P 5-107 None
5nrg X-ray 3.44 P 5-107 None
4wce X-ray 3.53 P 5-107 None
5hl7 X-ray 3.55 P 5-107 None
4wfb X-ray 3.43 P 5-107 None
4wf9 X-ray 3.43 P 5-107 None
4wfa X-ray 3.39 P 5-107 None


© NPIDB team 2003 - 2019

text