Pfam domain
Pfam family: Ribosomal_L16 (PF00252.17)
Uniprot AC: Q2FW13
RecName: 50S ribosomal protein L16
Begin-End: 4-132
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
PKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKRGGK
VWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRLASH
KLPVKTKFV
Structures of the domain Q2FW13 4-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 J 4-132 None
5nrg X-ray 3.44 J 4-132 None
4wce X-ray 3.53 J 4-132 None
5hl7 X-ray 3.55 J 4-132 None
4wfb X-ray 3.43 J 4-132 None
4wf9 X-ray 3.43 J 4-132 None
4wfa X-ray 3.39 J 4-132 None


© NPIDB team 2003 - 2019

text