Pfam domain
Pfam family: Ribosomal_L14 (PF00238.18)
Uniprot AC: Q2FW16
RecName: 50S ribosomal protein L14
Begin-End: 1-122
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKA
VIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPE
VL
Structures of the domain Q2FW16 1-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 H 1-122 None
5nrg X-ray 3.44 H 1-122 None
4wce X-ray 3.53 H 1-122 None
5hl7 X-ray 3.55 H 1-122 None
4wfb X-ray 3.43 H 1-122 None
4wf9 X-ray 3.43 H 1-122 None
4wfa X-ray 3.39 H 1-122 None


© NPIDB team 2003 - 2019

text