Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: Q2FW17
RecName: 50S ribosomal protein L24
Begin-End: 38-101
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
VNIMKKHQKPTQLNPEGGILETEAAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKS
GEEI
Structures of the domain Q2FW17 38-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 R 38-101 None
5nrg X-ray 3.44 R 38-101 None
4wce X-ray 3.53 R 38-101 None
5hl7 X-ray 3.55 R 38-101 None
4wfb X-ray 3.43 R 38-101 None
4wf9 X-ray 3.43 R 38-101 None
4wfa X-ray 3.39 R 38-101 None


© NPIDB team 2003 - 2019

text