Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: Q2FW18
RecName: 50S ribosomal protein L5
Begin-End: 24-80
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
SVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTKAKKSIATFRLR
Structures of the domain Q2FW18 24-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 D 24-80 None
5nrg X-ray 3.44 D 24-80 None
4wce X-ray 3.53 D 24-80 None
5hl7 X-ray 3.55 D 24-80 None
4wfb X-ray 3.43 D 24-80 None
4wf9 X-ray 3.43 D 24-80 None
4wfa X-ray 3.39 D 24-80 None


© NPIDB team 2003 - 2019

text