Pfam domain
Pfam family: Ribosomal_L5_C (PF00673.20)
Uniprot AC: Q2FW18
RecName: 50S ribosomal protein L5
Begin-End: 84-177
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
PIGAKVTLRGERMYEFLDKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDY
DKVSKVRGMDIVIVTTANTDEEARELLANFGMPF
Structures of the domain Q2FW18 84-177
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nrg X-ray 3.44 D 84-155 None


© NPIDB team 2003 - 2019

text