Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: Q2FW21
RecName: 50S ribosomal protein L6
Begin-End: 18-82
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
TFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQ
GVSQG
Structures of the domain Q2FW21 18-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 E 20-82 None
5nrg X-ray 3.44 E 20-82 None
4wce X-ray 3.53 E 20-82 None
5hl7 X-ray 3.55 E 20-82 None
4wfb X-ray 3.43 E 20-82 None
4wf9 X-ray 3.43 E 20-82 None
4wfa X-ray 3.39 E 17-82 None


© NPIDB team 2003 - 2019

text