Pfam domain
Pfam family: Ribosomal_L36 (PF00444.17)
Uniprot AC: Q2FW29
RecName: 50S ribosomal protein L36
Begin-End: 1-37
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
Structures of the domain Q2FW29 1-37
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wce X-ray 3.53 4 1-37 None
5hl7 X-ray 3.55 4 1-36 None
4wfb X-ray 3.43 4 1-37 None
4wfa X-ray 3.39 4 1-37 None


© NPIDB team 2003 - 2019

text