Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: Q2FW33
RecName: 50S ribosomal protein L17
Begin-End: 16-122
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
MLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRRNAAKTLRNVEILNED
ETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIELV
Structures of the domain Q2FW33 16-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 K 16-122 None
5nrg X-ray 3.44 K 16-122 None
4wce X-ray 3.53 K 16-122 None
5hl7 X-ray 3.55 K 16-122 None
4wfb X-ray 3.43 K 16-122 None
4wf9 X-ray 3.43 K 16-122 None
4wfa X-ray 3.39 K 16-122 None


© NPIDB team 2003 - 2019

text