Pfam domain
Pfam family: Ribosomal_L13 (PF00572.17)
Uniprot AC: Q2FW38
RecName: 50S ribosomal protein L13
Begin-End: 15-139
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
KWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINASKIEFTGNKETDKV
YYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHA
AQQPE
Structures of the domain Q2FW38 15-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 G 15-139 None
5nrg X-ray 3.44 G 15-139 None
4wce X-ray 3.53 G 15-139 None
5hl7 X-ray 3.55 G 15-139 None
4wfb X-ray 3.43 G 15-139 None
4wf9 X-ray 3.43 G 15-139 None
4wfa X-ray 3.39 G 15-139 None


© NPIDB team 2003 - 2019

text