Pfam domain
Pfam family: PemK_toxin (PF02452.16)
Uniprot AC: Q2FWI8
RecName: Endoribonuclease MazF
Begin-End: 3-110
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
RRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIE
KKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISL
Structures of the domain Q2FWI8 3-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5dlo X-ray 1.4 A 2-108 None


© NPIDB team 2003 - 2019

text