Pfam domain
Pfam family: Ribosomal_L35p (PF01632.18)
Uniprot AC: Q2FXQ0
RecName: 50S ribosomal protein L35
Begin-End: 2-61
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQL
Structures of the domain Q2FXQ0 2-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 3 2-61 None
5nrg X-ray 3.44 3 2-62 None
4wce X-ray 3.53 3 2-61 None
5hl7 X-ray 3.55 3 2-61 None
4wfb X-ray 3.43 3 2-61 None
4wf9 X-ray 3.43 3 2-61 None
4wfa X-ray 3.39 3 2-61 None


© NPIDB team 2003 - 2019

text