Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: Q2FXQ1
RecName: 50S ribosomal protein L20
Begin-End: 3-109
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
RVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKLWI
TRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQL
Structures of the domain Q2FXQ1 3-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 N 3-109 None
5nrg X-ray 3.44 N 3-109 None
4wce X-ray 3.53 N 3-109 None
5hl7 X-ray 3.55 N 3-109 None
4wfb X-ray 3.43 N 3-109 None
4wf9 X-ray 3.43 N 3-109 None
4wfa X-ray 3.39 N 3-109 None


© NPIDB team 2003 - 2019

text