Pfam domain
Pfam family: Ribosomal_L21p (PF00829.20)
Uniprot AC: Q2FXS8
RecName: 50S ribosomal protein L21
Begin-End: 1-100
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTA
TVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKI
Structures of the domain Q2FXS8 1-100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 O 1-100 None
5nrg X-ray 3.44 O 1-100 None
4wce X-ray 3.53 O 1-100 None
5hl7 X-ray 3.55 O 1-100 None
4wfb X-ray 3.43 O 1-100 None
4wf9 X-ray 3.43 O 1-100 None
4wfa X-ray 3.39 O 1-100 None


© NPIDB team 2003 - 2019

text