Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: Q2FXT0
RecName: 50S ribosomal protein L27
Begin-End: 19-89
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
KNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGVVKFE
RKGRDKKQVSV
Structures of the domain Q2FXT0 19-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 T 19-89 None
5nrg X-ray 3.44 T 19-89 None
4wce X-ray 3.53 T 19-89 None
5hl7 X-ray 3.55 T 19-89 None
4wfb X-ray 3.43 T 19-89 None
4wf9 X-ray 3.43 T 19-89 None
4wfa X-ray 3.39 T 19-89 None


© NPIDB team 2003 - 2019

text