Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: Q2FZ42
RecName: 50S ribosomal protein L19
Begin-End: 5-110
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
KLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSETFTVR
KISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAA
Structures of the domain Q2FZ42 5-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 M 6-110 None
5nrg X-ray 3.44 M 6-113 None
4wce X-ray 3.53 M 6-110 None
5hl7 X-ray 3.55 M 6-110 None
4wfb X-ray 3.43 M 6-110 None
4wf9 X-ray 3.43 M 6-111 None
4wfa X-ray 3.39 M 6-110 None


© NPIDB team 2003 - 2019

text