Pfam domain
Pfam family: Ribosomal_L28 (PF00830.18)
Uniprot AC: Q2FZ60
RecName: 50S ribosomal protein L28
Begin-End: 10-55
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
RKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALK
Structures of the domain Q2FZ60 10-55
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 U 14-55 None
4wce X-ray 3.53 U 11-55 None
5hl7 X-ray 3.55 U 14-54 None
4wfb X-ray 3.43 U 13-55 None
4wfa X-ray 3.39 U 13-55 None


© NPIDB team 2003 - 2019

text