Pfam domain
Pfam family: Ribosomal_L32p (PF01783.22)
Uniprot AC: Q2FZF1
RecName: 50S ribosomal protein L32
Begin-End: 2-44
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
AVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGREYKLSHRVC
Structures of the domain Q2FZF1 2-44
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 Z 2-44 None
5nrg X-ray 3.44 Z 2-45 None
4wce X-ray 3.53 Z 2-44 None
5hl7 X-ray 3.55 Z 2-44 None
4wfb X-ray 3.43 Z 2-45 None
4wf9 X-ray 3.43 Z 2-46 None
4wfa X-ray 3.39 Z 2-45 None


© NPIDB team 2003 - 2019

text