Pfam domain
Pfam family: Ribosomal_L25p (PF01386.18)
Uniprot AC: Q2G0S0
RecName: 50S ribosomal protein L25
Begin-End: 4-91
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
LKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGVIEL
GVGSKTIKVMVADYQFDPLKNQITHIDF
Structures of the domain Q2G0S0 4-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 S 8-91 None
5nrg X-ray 3.44 S 8-91 None
4wce X-ray 3.53 S 8-91 None
5hl7 X-ray 3.55 S 8-91 None
4wfb X-ray 3.43 S 8-91 None


© NPIDB team 2003 - 2019

text