Pfam domain
Pfam family: Ribosomal_TL5_C (PF14693.5)
Uniprot AC: Q2G0S0
RecName: 50S ribosomal protein L25
Begin-End: 99-176
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
ERTVEVPVQLVGEAVGAKEGGVVEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVAD
VKVTGDFKIENDSAESVV
Structures of the domain Q2G0S0 99-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nrg X-ray 3.44 S 101-176 None


© NPIDB team 2003 - 2019

text