Pfam domain
Pfam family: PhdYeFM_antitox (PF02604.21)
Uniprot AC: Q2G285
RecName: Antitoxin
Begin-End: 1-54
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb H-Mj 

Sequence:
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYL
Structures of the domain Q2G285 1-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6l8e X-ray 2.35 B 1-54  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text