Pfam domain
Pfam family: PhdYeFM_antitox (PF02604.21)
Uniprot AC: Q2G285
RecName: Antitoxin
Begin-End: 1-74
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNN
AEHLAQSIADLERG
Structures of the domain Q2G285 1-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6l8e X-ray 2.35 I 1-74  H-Bb H-Mj S-Bb L-Bb 
6l8e X-ray 2.35 K 1-74  H-Bb H-Mj 
6l8e X-ray 2.35 A 1-74  H-Bb H-Mj S-Bb 
6l8e X-ray 2.35 C 1-74  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text