Pfam domain
Pfam family: YoeB_toxin (PF06769.16)
Uniprot AC: Q2G286
RecName: Putative mRNA interferase YoeB
Begin-End: 8-88
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
FSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHE
HRLVYTVDDNHIKIASCKYHY
Structures of the domain Q2G286 8-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6l8e X-ray 2.35 M 8-88 None
6l8e X-ray 2.35 N 8-88 None
6l8e X-ray 2.35 F 8-88 None
6l8e X-ray 2.35 E 8-88 None


© NPIDB team 2003 - 2021

text