Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: Q2HJI0
RecName: 39S ribosomal protein L19, mitochondrial
Begin-End: 108-198
Organism: Bos taurus
Interaction Mode:   

Sequence:
IPEFYVGSILRVTTADPYANGKTSQFLGICIQRSGKGLGATFILRNTIEGQGVEICFELY
NPRIQEIQVVKLEKRLDDSLLYLRDALPEYS
Structures of the domain Q2HJI0 108-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 K 96-181 None


© NPIDB team 2003 - 2019

text