Pfam domain
Pfam family: RNA_pol_Rpb5_C (PF01191.18)
Uniprot AC: Q2T9T3
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC1
Begin-End: 137-209
Organism: Bos taurus
Interaction Mode:   

Sequence:
INITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRP
SETAGRYITYRLV
Structures of the domain Q2T9T3 137-209
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 E 137-209 None
5flm X-ray 3.4 E 137-209 None


© NPIDB team 2003 - 2019

text