Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: Q2TA12
RecName: 39S ribosomal protein L2, mitochondrial
Begin-End: 127-166
Organism: Bos taurus
Interaction Mode:   

Sequence:
VIVVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTILN
Structures of the domain Q2TA12 127-166
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 B 126-164 None
3iy9 X-ray 14.1 B 190-228 None


© NPIDB team 2003 - 2019

text