Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q2TAY7
RecName: WD40 repeat-containing protein SMU1
Begin-End: 204-242
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QLSRHIKFGQKSHVECARFSPDGQYLVTGSVDGFIEVWN
Structures of the domain Q2TAY7 204-242
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 L 339-377 None
5o9z X-ray 4.5 L 296-333 None
5o9z X-ray 4.5 L 267-292 None
5o9z X-ray 4.5 L 207-242 None


© NPIDB team 2003 - 2019

text